Protein Info for Ga0059261_1610 in Sphingomonas koreensis DSMZ 15582

Annotation: CBS domain/Transporter associated domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF00571: CBS" amino acids 82 to 137 (56 residues), 35.6 bits, see alignment E=9.9e-13 amino acids 150 to 201 (52 residues), 22.4 bits, see alignment 1.3e-08 PF03471: CorC_HlyC" amino acids 219 to 296 (78 residues), 59.9 bits, see alignment E=2e-20

Best Hits

KEGG orthology group: None (inferred from 64% identity to sjp:SJA_C1-20600)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WBP6 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Ga0059261_1610 CBS domain/Transporter associated domain (Sphingomonas koreensis DSMZ 15582)
MADGSSSNGNGESSSEGGIWRGLRTLLFGEENNETLRERIEDAIDEVEEDGEGKPAKKGD
LSPLERKMLRNLLHFGERDAGDVGVPRADIIAVEEKTSFAELVQLFAEAGHSRLPVYREK
LDRVIGMIHIKDVFSTLAAGAGPPAKITGLMRQPLYVPQSMGTLDLLAQMQASRTHLAIV
LDEYSGTEGLITIEDLVEEIVGEIDDEHDDAPEALFVPLDDGGWDADARAELEDVAAAID
PRLGEVEEDIETLGGLAFILAGHVPEAGECLNHPSGWTLEVLEADATRVRRVRLHPPAKR
EESEE