Protein Info for Ga0059261_1595 in Sphingomonas koreensis DSMZ 15582

Annotation: Membrane protein involved in the export of O-antigen and teichoic acid

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 transmembrane" amino acids 25 to 48 (24 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 93 to 118 (26 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 220 to 237 (18 residues), see Phobius details amino acids 254 to 273 (20 residues), see Phobius details amino acids 294 to 317 (24 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details amino acids 366 to 386 (21 residues), see Phobius details amino acids 391 to 412 (22 residues), see Phobius details amino acids 423 to 444 (22 residues), see Phobius details amino acids 456 to 478 (23 residues), see Phobius details PF01943: Polysacc_synt" amino acids 24 to 286 (263 residues), 60.4 bits, see alignment E=3e-20 PF13440: Polysacc_synt_3" amino acids 46 to 336 (291 residues), 204.5 bits, see alignment E=3.3e-64 PF14667: Polysacc_synt_C" amino acids 338 to 475 (138 residues), 44.2 bits, see alignment E=3.3e-15

Best Hits

KEGG orthology group: None (inferred from 53% identity to sch:Sphch_2292)

Predicted SEED Role

"Lipopolysaccharide biosynthesis protein WzxC" in subsystem Colanic acid biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WBS7 at UniProt or InterPro

Protein Sequence (489 amino acids)

>Ga0059261_1595 Membrane protein involved in the export of O-antigen and teichoic acid (Sphingomonas koreensis DSMZ 15582)
MTESTAEPSNQGRDSLRNQVRSAVIWRSGTQVLGQIIAWASTFLVIRMLDPTDYGLFAMT
QVILVLLNMLNGYGLASAIIQKPDVDDRAVRQLFGMLLLLNFALGVAQFLMAPLAAAYYR
QDIVADLLRVQSLLYIATPFIALPYALLARAMDFRKQAQVNLISATAGALAALGGAYAGL
GVWTLVLAPIVLFGTRAIGMTWAARSLMWPSFDFRGAGGMARYGGLMAAGQLFWFVQSQA
DVFIAGRLFDPHWLGIYTTSLFLTQILVQKFIPALNEVAFSAYSRMQHDAAGATIAFAKS
VRLIMVAAMPFYLGLAATAEPLVHVALGEKWMEAAPIVRILSLAMPFMTLQILFAAATDA
RGRPGIGAQISAIGAFLLPAAFLIGVQWGVIGLALTWIAIWPVFLVITAARSLPVIGLSW
RDWIAAVLPPITAASAMALAVVLIDRMLPPLGPLPHLLILSGAGAAIYGAWLWLFARATV
EDAIGMIRR