Protein Info for Ga0059261_1576 in Sphingomonas koreensis DSMZ 15582

Annotation: 5'-deoxy-5'-methylthioadenosine phosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01694: methylthioadenosine phosphorylase
  • amino acids 5 to 243 (239 residues), 288.1 bits, E=2.5e-90
• PF01048: PNP_UDP_1
  • amino acids 6 to 244 (239 residues), 144.3 bits, E=2.1e-46

Best Hits

Swiss-Prot: 58% identical to MTAP_RHOS4: S-methyl-5'-thioadenosine phosphorylase (mtnP) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K00772, 5'-methylthioadenosine phosphorylase [EC: 2.4.2.28] (inferred from 61% identity to eli:ELI_01490)

MetaCyc: 56% identical to 5'-fluoro-5'-deoxy-adenosine phosphorylase (Streptantibioticus cattleyicolor)
Purine-nucleoside phosphorylase. [EC: 2.4.2.1]

Predicted SEED Role

"5'-methylthioadenosine phosphorylase (EC 2.4.2.28)" in subsystem Methionine Salvage (EC 2.4.2.28)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (11/14 steps found)
• S-methyl-5'-thioadenosine degradation II (1/1 steps found)
• adenine and adenosine salvage I (1/2 steps found)
• guanine and guanosine salvage I (1/2 steps found)
• xanthine and xanthosine salvage (1/2 steps found)
• inosine 5'-phosphate degradation (2/4 steps found)
• 5'-deoxyadenosine degradation I (1/3 steps found)
• adenine and adenosine salvage V (1/3 steps found)
• purine deoxyribonucleosides degradation II (1/3 steps found)
• superpathway of guanine and guanosine salvage (1/3 steps found)
• adenosine nucleotides degradation II (2/5 steps found)
• adenine and adenosine salvage III (1/4 steps found)
• guanosine nucleotides degradation III (1/4 steps found)
• purine deoxyribonucleosides degradation I (1/4 steps found)
• purine nucleotides degradation II (aerobic) (5/11 steps found)
• ureide biosynthesis (2/7 steps found)
• fluoroacetate and fluorothreonine biosynthesis (1/6 steps found)
• purine ribonucleosides degradation (1/6 steps found)
• superpathway of purine deoxyribonucleosides degradation (1/7 steps found)
• L-methionine salvage cycle III (3/11 steps found)
• arsenic detoxification (mammals) (7/17 steps found)
• nucleoside and nucleotide degradation (archaea) (1/10 steps found)
• salinosporamide A biosynthesis (2/15 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Methionine metabolism
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.1 or 2.4.2.28

Sequence Analysis Tools

See A0A2M8WBL3 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Ga0059261_1576 5'-deoxy-5'-methylthioadenosine phosphorylase (Sphingomonas koreensis DSMZ 15582)
VSGWHIGIIGGSGLYDVEGIERGEWVTVASPWGEASDAIFTGRMGHARVSFLPRHGRGHR
LSPSQLNNRANIDCLKRMGVTDVLAVSSVGGLTEERAPGTFTVADQFIDRTKGRPSSFYG
SGMVAHVSMADPVCPRLSQFAAAAARAAGAQVHAGGTYLAMEGPQFSTRAESHLYRSWGC
DIIGMTAMPEARLAREAELPYALVGMVTDYDCWREEEAAVDVAQVIEQLSSNAAKARAMV
TALLHGLPETREASPIDTCLDAALITVPSARDPALLAKLDAVAGRVLAG