Protein Info for Ga0059261_1576 in Sphingomonas koreensis DSMZ 15582

Annotation: 5'-deoxy-5'-methylthioadenosine phosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 TIGR01694: methylthioadenosine phosphorylase" amino acids 5 to 243 (239 residues), 288.1 bits, see alignment E=2.5e-90 PF01048: PNP_UDP_1" amino acids 6 to 244 (239 residues), 144.3 bits, see alignment E=2.1e-46

Best Hits

Swiss-Prot: 58% identical to MTAP_RHOS4: S-methyl-5'-thioadenosine phosphorylase (mtnP) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K00772, 5'-methylthioadenosine phosphorylase [EC: 2.4.2.28] (inferred from 61% identity to eli:ELI_01490)

MetaCyc: 56% identical to 5'-fluoro-5'-deoxy-adenosine phosphorylase (Streptantibioticus cattleyicolor)
Purine-nucleoside phosphorylase. [EC: 2.4.2.1]

Predicted SEED Role

"5'-methylthioadenosine phosphorylase (EC 2.4.2.28)" in subsystem Methionine Salvage (EC 2.4.2.28)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.1 or 2.4.2.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WBL3 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Ga0059261_1576 5'-deoxy-5'-methylthioadenosine phosphorylase (Sphingomonas koreensis DSMZ 15582)
VSGWHIGIIGGSGLYDVEGIERGEWVTVASPWGEASDAIFTGRMGHARVSFLPRHGRGHR
LSPSQLNNRANIDCLKRMGVTDVLAVSSVGGLTEERAPGTFTVADQFIDRTKGRPSSFYG
SGMVAHVSMADPVCPRLSQFAAAAARAAGAQVHAGGTYLAMEGPQFSTRAESHLYRSWGC
DIIGMTAMPEARLAREAELPYALVGMVTDYDCWREEEAAVDVAQVIEQLSSNAAKARAMV
TALLHGLPETREASPIDTCLDAALITVPSARDPALLAKLDAVAGRVLAG