Protein Info for Ga0059261_1528 in Sphingomonas koreensis DSMZ 15582

Annotation: phosphoribosylformylglycinamidine synthase, purS protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00302: phosphoribosylformylglycinamidine synthase, purS protein
  • amino acids 1 to 74 (74 residues), 88.3 bits, E=1.5e-29
• PF02700: PurS
  • amino acids 2 to 74 (73 residues), 96.8 bits, E=3.5e-32

Best Hits

Swiss-Prot: 49% identical to PURS_BACSU: Phosphoribosylformylglycinamidine synthase subunit PurS (purS) from Bacillus subtilis (strain 168)

KEGG orthology group: K01952, phosphoribosylformylglycinamidine synthase [EC: 6.3.5.3] (inferred from 77% identity to sch:Sphch_0395)

MetaCyc: 49% identical to factor required for phosphoribosylformylglycinamidine synthetase activity (Bacillus subtilis subtilis 168)
Phosphoribosylformylglycinamidine synthase. [EC: 6.3.5.3]

Predicted SEED Role

"Phosphoribosylformylglycinamidine synthase, PurS subunit (EC 6.3.5.3)" in subsystem De Novo Purine Biosynthesis (EC 6.3.5.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.3

Use Curated BLAST to search for 6.3.5.3

Sequence Analysis Tools

See A0A1L6J8P8 at UniProt or InterPro

Protein Sequence (81 amino acids)

>Ga0059261_1528 phosphoribosylformylglycinamidine synthase, purS protein (Sphingomonas koreensis DSMZ 15582)
MKLRIVVTLKNGVLDPQGKAIEHALASLGFSGVGEARVGKLIELEVADGTSDADIDAMCQ
KLLANTVIENYRVERPEVSGQ