Protein Info for Ga0059261_1485 in Sphingomonas koreensis DSMZ 15582

Annotation: Type II secretory pathway, prepilin signal peptidase PulO and related peptidases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 87 to 116 (30 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 151 to 168 (18 residues), see Phobius details amino acids 188 to 215 (28 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details PF06750: A24_N_bact" amino acids 13 to 90 (78 residues), 80.9 bits, see alignment E=5.8e-27 PF01478: Peptidase_A24" amino acids 106 to 213 (108 residues), 60.2 bits, see alignment E=2.4e-20

Best Hits

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 59% identity to swi:Swit_1113)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WBA5 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Ga0059261_1485 Type II secretory pathway, prepilin signal peptidase PulO and related peptidases (Sphingomonas koreensis DSMZ 15582)
LIESWIWPAALGVLGLIFGSFIATVALRWPEGRSALRGRSQCDSCRKALRAHELVPLLSY
ALQRGRCRACGAAIHPGHPGVEVAGMLIGIAAGLVAPGWHGVAGAVFGWLLLALAALDLA
AFWLPNALTALLALAGIVDGLFFPPNLADRLLGGLFGFGLLWLVAFTYRHVRGREGLGGG
DPKMFGGIGLWLGASMLAPVLLAASLIGLAVALAVRISGRKMEMTSRLPLGTLLAVAAFP
AWLYSTGV