Protein Info for Ga0059261_1426 in Sphingomonas koreensis DSMZ 15582

Annotation: O-6-methylguanine DNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF02805: Ada_Zn_binding" amino acids 29 to 92 (64 residues), 94.7 bits, see alignment E=6.8e-31 PF00165: HTH_AraC" amino acids 115 to 146 (32 residues), 32.1 bits, see alignment (E = 2.4e-11) PF12833: HTH_18" amino acids 120 to 197 (78 residues), 69.8 bits, see alignment E=4.9e-23 TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase" amino acids 280 to 359 (80 residues), 97.1 bits, see alignment E=2.4e-32 PF01035: DNA_binding_1" amino acids 281 to 361 (81 residues), 99.7 bits, see alignment E=1.7e-32

Best Hits

Swiss-Prot: 44% identical to ADA_ECOLI: Bifunctional transcriptional activator/DNA repair enzyme Ada (ada) from Escherichia coli (strain K12)

KEGG orthology group: K10778, AraC family transcriptional regulator, regulatory protein of adaptative response / methylated-DNA-[protein]-cysteine methyltransferase [EC: 2.1.1.63] (inferred from 62% identity to sch:Sphch_0072)

MetaCyc: 44% identical to DNA-binding transcriptional dual regulator / DNA repair protein Ada (Escherichia coli K-12 substr. MG1655)
2.1.1.M37 [EC: 2.1.1.M37]; Methylated-DNA--[protein]-cysteine S-methyltransferase. [EC: 2.1.1.M37, 2.1.1.63]; 2.1.1.63 [EC: 2.1.1.M37, 2.1.1.63]

Predicted SEED Role

"ADA regulatory protein / Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63)" in subsystem DNA repair, bacterial (EC 2.1.1.63)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.63

Use Curated BLAST to search for 2.1.1.63 or 2.1.1.M37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WB48 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Ga0059261_1426 O-6-methylguanine DNA methyltransferase (Sphingomonas koreensis DSMZ 15582)
MFGRKRREAVLVPDAYIGTMSKMIPDDEAWEAFQRRDRAYDGRVIAGVLTTGIYCKPSCA
ARHPKRENVVFFPDAESARATGLRACLRCKPDEIGRERIAVAKAVALLEAAEDAVTLDTL
ADHVGYAPHHFQRLFKRATGVTPAAYARSLRARRAAEALTAEDNVTTAIYEAGYSAPSRF
YETSNARLGMTPSAWRNGGAGMTIRWIVADTSLGALLIAATDKGLCRVAFDEDSLSLATR
FPRAEIVPGGAALAALAMQVVAEVEQPGRHADLPLDVRGTAFQEAVWQALRAVPPGETVS
YAQLAVAAGSPGAVRAAGTACGANNVAVVIPCHRAQRSDGSMGGYAYGVDRKKVLRRREG
VTE