Protein Info for Ga0059261_1381 in Sphingomonas koreensis DSMZ 15582

Annotation: Membrane protease subunits, stomatin/prohibitin homologs

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF01145: Band_7" amino acids 28 to 227 (200 residues), 99.5 bits, see alignment E=1.1e-32

Best Hits

KEGG orthology group: K04087, membrane protease subunit HflC [EC: 3.4.-.-] (inferred from 66% identity to sch:Sphch_3128)

Predicted SEED Role

"HflC protein" in subsystem Hfl operon

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6J952 at UniProt or InterPro

Protein Sequence (287 amino acids)

>Ga0059261_1381 Membrane protease subunits, stomatin/prohibitin homologs (Sphingomonas koreensis DSMZ 15582)
MNGVMNRPVLLGGLALVILFLLFSTVAIVPETKQAVILRFEQPVRTINQWQPGEQFGRTT
GAGLIARWPLMERIVWVDKRVLDIELENQPVLSTDQLRLEVDAFARFRVVDPLRMVVTAG
TETRVADQLEPLFGSALRAELGKRPFASLLSPERTAVMDNIQAGLQRYASQYGVQIVDVR
IKHADLPSGSPLDSALQRMRTAREQEATTIRANGQKDAQIIRAEADARAAQIYATSFNKD
PQFYDFWRAMQSYRTTFIGDPRQKQGETSIILSPDNDYLREFRGRSR