Protein Info for Ga0059261_1363 in Sphingomonas koreensis DSMZ 15582

Annotation: PEP-CTERM-box response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 TIGR02915: PEP-CTERM-box response regulator transcription factor" amino acids 7 to 447 (441 residues), 665.5 bits, see alignment E=1.9e-204 PF00072: Response_reg" amino acids 8 to 115 (108 residues), 57.1 bits, see alignment E=5e-19 PF00158: Sigma54_activat" amino acids 149 to 312 (164 residues), 228.9 bits, see alignment E=7.5e-72 PF14532: Sigma54_activ_2" amino acids 152 to 318 (167 residues), 67.2 bits, see alignment E=4.7e-22 PF07728: AAA_5" amino acids 172 to 281 (110 residues), 33.6 bits, see alignment E=9.4e-12 PF02954: HTH_8" amino acids 406 to 445 (40 residues), 44.2 bits, see alignment 3.2e-15

Best Hits

KEGG orthology group: None (inferred from 76% identity to sch:Sphch_1155)

Predicted SEED Role

"Response regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WB04 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Ga0059261_1363 PEP-CTERM-box response regulator transcription factor (Sphingomonas koreensis DSMZ 15582)
MNDKPKLLIVEDDAGLQRQLRWAYEGYEILTAGDREGAIAMLRAEEPAVVTLDLGLPPDP
DGTSEGFAVLETILALKPDTRVIVASGHGERESMLRAISMGAWDFYQKPIDIDALGLIVA
RAFHVHALEAENRRLAARAERGTALGGIVTGSPEMLKVTRTIERVAPADVSVMLLGASGT
GKELLARGLHDASRRKGEFVAINCAAIPETLLESELFGHEKGAFTGAVKTTEGKIEQAQG
GTLFLDEIGDVPLALQVKLLRFLQERVIERIGGRKPIAVDTRVVCATHQDIDAMIAAGTF
RDDLYYRLAEIVVRIPSLAERPGDAGLLARHLLHKHSSAMKLGTKSFAPDALDAIDAWHW
PGNVRELENRVKRAAIMADGKLVVAADLDLPAPEHAGPVNLKAVREAADRRAIIQALSRT
DGNISGTARLLGISRPTLYDLMKAYDLQP