Protein Info for Ga0059261_1360 in Sphingomonas koreensis DSMZ 15582

Annotation: mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR01479: mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase" amino acids 7 to 351 (345 residues), 381 bits, see alignment E=4.1e-118 PF00483: NTP_transferase" amino acids 9 to 285 (277 residues), 170.5 bits, see alignment E=2.5e-54

Best Hits

KEGG orthology group: K00971, mannose-1-phosphate guanylyltransferase [EC: 2.7.7.22] (inferred from 63% identity to swi:Swit_3438)

Predicted SEED Role

"Mannose-1-phosphate guanylyltransferase (GDP) (EC 2.7.7.22)" in subsystem Alginate metabolism or Mannose Metabolism (EC 2.7.7.22)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WAX6 at UniProt or InterPro

Protein Sequence (352 amino acids)

>Ga0059261_1360 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase (Sphingomonas koreensis DSMZ 15582)
MTDQKPIVPVILSGGSGIRLWPMSRPEMPKQMLALTAEETMLQLTARRTPAGDRFAAPVI
VANALHADMVEEQLGAVEARAQALILEPMGRNTAPAIALAALAAGGGSEPLLVMPSDHVI
GDVAAFHAAIDAALPLVEDGWLVTFGITPDAPETGYGYIKVGDAIRTGVHKVERFVEKPK
RDVAEAMIAAGGHAWNGGIFLFRADAYLDALGRFAPDMLVAVRAAMARAIREGTRILPDQ
IEFAKSPAESIDYAVMEKAERVAVVPVAMGWSDVGSWDALHAISDCDGAGNAFGGEVIAV
DTTDCLVRAGPGKRVALVGISDLIVVADGDDVLVLPRGRSQDVKRIIEAMNK