Protein Info for Ga0059261_1352 in Sphingomonas koreensis DSMZ 15582

Annotation: Co-chaperonin GroES (HSP10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00166: Cpn10
  • amino acids 2 to 94 (93 residues), 128.1 bits, E=5.3e-42

Best Hits

Swiss-Prot: 86% identical to CH10_SPHWW: 10 kDa chaperonin (groS) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K04078, chaperonin GroES (inferred from 86% identity to sjp:SJA_C1-21260)

MetaCyc: 53% identical to cochaperonin GroES (Escherichia coli K-12 substr. MG1655)
Non-chaperonin molecular chaperone ATPase. [EC: 3.6.4.10, 5.6.1.7]

Predicted SEED Role

"Heat shock protein 60 family co-chaperone GroES" in subsystem GroEL GroES

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.4.10 or 5.6.1.7

Sequence Analysis Tools

See A0A1L6JAB6 at UniProt or InterPro

Protein Sequence (95 amino acids)

>Ga0059261_1352 Co-chaperonin GroES (HSP10) (Sphingomonas koreensis DSMZ 15582)
MNFRPLHDRVLVRRVEAEAKTAGGIIIPDTAQEKPQEGEVVAAGSGAKNEKGEVTPLDVK
AGDRILFGKWSGTEVKVNGEDLLIMKESDILGIIA