Protein Info for Ga0059261_1343 in Sphingomonas koreensis DSMZ 15582

Annotation: dihydrolipoamide dehydrogenase (EC 1.8.1.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 6 to 464 (459 residues), 546 bits, E=3.5e-168
• PF07992: Pyr_redox_2
  • amino acids 6 to 327 (322 residues), 274.3 bits, E=6e-85
• PF01134: GIDA
  • amino acids 7 to 98 (92 residues), 25.2 bits, E=3.8e-09
• PF12831: FAD_oxidored
  • amino acids 7 to 75 (69 residues), 34 bits, E=1e-11
• PF00890: FAD_binding_2
  • amino acids 7 to 43 (37 residues), 27.1 bits, 1.1e-09
• PF00070: Pyr_redox
  • amino acids 174 to 250 (77 residues), 79.3 bits, E=1.2e-25
• PF02852: Pyr_redox_dim
  • amino acids 346 to 454 (109 residues), 129.1 bits, E=3.7e-41

Best Hits

Swiss-Prot: 57% identical to DLDH3_PSEPU: Dihydrolipoyl dehydrogenase 3 (lpd3) from Pseudomonas putida

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 84% identity to swi:Swit_1296)

MetaCyc: 54% identical to glycine cleavage system L protein 1 (Arabidopsis thaliana col)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)" in subsystem TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• folate transformations III (E. coli) (8/9 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• glycine degradation (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• folate transformations II (plants) (8/11 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (2/3 steps found)
• photorespiration I (6/9 steps found)
• photorespiration III (6/9 steps found)
• photorespiration II (6/10 steps found)
• folate transformations I (8/13 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (5/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.4.1.27 or 1.8.1.4

Sequence Analysis Tools

See A0A2M8WAY3 at UniProt or InterPro

Protein Sequence (464 amino acids)

>Ga0059261_1343 dihydrolipoamide dehydrogenase (EC 1.8.1.4) (Sphingomonas koreensis DSMZ 15582)
MAEYDFDVLVIGSGPGGYVAAIRAAQLGLKTACAEGRETLGGTCLNVGCIPSKALLHASE
LYEEAASGALAKLGVKLGKVELDLDAMHAQRLDAVKGLTGGIEFLFKKNKVEWLKGYATF
TGKDSVKVGDREVRAKNIVIATGSSVTPLPGVEIDQKIVVDSTGALELAKVPEHLVVIGG
GVIGLELGSVWRRVGAKVTVVEYLDQILPGFDADVRKEAARLFKKQGIEFKTGTKVTGVA
VKGGKATITVEPAAGGAAETIEADNVLVAIGRKPNTDGLGLDAAGLTVNQRGQIETDHSF
KTSVPGIWAIGDVIPGPMLAHKAEDEGIAVAENIAGLTGIVNHDVIPSVVYTMPEIAGVG
LTEEAAKAKGEVKVGKFPMAGNSRAKTNHEPDGFVKVIADAKTDRVLGVWIITSVAGTMI
AQAAQAMEFGATSEDIAYTCHAHPTHSEAIKEAAMAVTGKPIHI