Protein Info for Ga0059261_1281 in Sphingomonas koreensis DSMZ 15582

Annotation: histidinol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 PF00815: Histidinol_dh" amino acids 23 to 427 (405 residues), 555.1 bits, see alignment E=5.3e-171 TIGR00069: histidinol dehydrogenase" amino acids 33 to 426 (394 residues), 524.6 bits, see alignment E=9.7e-162

Best Hits

Swiss-Prot: 67% identical to HISX_ZYMMO: Histidinol dehydrogenase (hisD) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K00013, histidinol dehydrogenase [EC: 1.1.1.23] (inferred from 77% identity to sch:Sphch_2383)

Predicted SEED Role

"Histidinol dehydrogenase (EC 1.1.1.23)" in subsystem Histidine Biosynthesis (EC 1.1.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6J974 at UniProt or InterPro

Protein Sequence (428 amino acids)

>Ga0059261_1281 histidinol dehydrogenase (Sphingomonas koreensis DSMZ 15582)
MIRLSTTEPGFAQAFRELVDARREADADVARDVRTIVASVRDEGDAALHAFTRKFDRHDL
NETGWRIEKADCAAAFDALEPKLRDALQLAADRITAYHEKQKPADSDTTDAAGVRTGARW
QAVEAAGVYVPGGRAAYPSSVLMNAIPAKVAGVDRLVMVTPTPDGEVNPLVLAAAHIAGV
DEIWRVGGAQAIAALAYGTGRIAAVDVITGPGNAWVAEAKRQLYGVVGIDMVAGPSEIVV
IADGKNDPEWIAADLLSQSEHDPTSQSILLTDDAIFAGKVAEAVDLQIGTLSTKGVARQS
WDANGAIILTGSLDEAIPLVNKLAPEHLELACDDPDALFARVRHAGSVFLGRMTPEAIGD
YVAGPNHVLPTGRRARFASGLSVLDFMKRTSFLALDAAGLAAIGPAAVALAEAEGLPAHA
RSVSLRLP