Protein Info for Ga0059261_1223 in Sphingomonas koreensis DSMZ 15582

Annotation: Predicted unusual protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 transmembrane" amino acids 495 to 525 (31 residues), see Phobius details PF03109: ABC1" amino acids 90 to 331 (242 residues), 177 bits, see alignment E=3.8e-56

Best Hits

KEGG orthology group: None (inferred from 64% identity to eli:ELI_14905)

Predicted SEED Role

"ABC1 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WAQ2 at UniProt or InterPro

Protein Sequence (528 amino acids)

>Ga0059261_1223 Predicted unusual protein kinase (Sphingomonas koreensis DSMZ 15582)
MASPPEKPISSIARAAEIGQILLRHGAKNLAGALGFIPSSSNVIDPREFRPAAVVAFLRD
IGPVGIKLGQLLATRSDLFTEHWITAFSTLHDQVSPVPFADIEPVLASSWGEDWRNDFAQ
FDEQPLASASIAQTYSAKLRDGSEVIVKVRRPGTAARMEADVRLLVRLAEIAEARSPDIA
RYRPVEFLRTFGRNLAWEMDLAAESRACERIGAYLDTIGVRTPAIHWELTGLRVNVQERL
YGRPASSLGSPSGDPRVAAFAKSYANAVLRMIILNGEFHGDPHPGNVFLIGEQDVGFIDF
GSVGTLTKTRRDEIVRLVLAIAGEETSEVADVLLAWAGAPKVDRDALAVDLDHLIGEFRG
TVLSGIEFSQIFSRVFDLLRDYQLVLPPDLAILLRTLLTAEGVVRSLAPDYNIAEDTRPI
MTELLAERFSLGSARSGLKKLRGQLLGLSASLPDILATANSIAKSGYVPVQLDPLSIEQL
AGLRNERQSLKGPLAAALIVASALLVDQSWPLAGGALAIAGVVLVRKS