Protein Info for Ga0059261_1204 in Sphingomonas koreensis DSMZ 15582

Annotation: Superoxide dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02777: Sod_Fe_C
  • amino acids 123 to 222 (100 residues), 90.9 bits, E=2.5e-30

Best Hits

Swiss-Prot: 65% identical to SODM_CUPMC: Superoxide dismutase [Fe] (chrC) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 67% identity to swi:Swit_2537)

Predicted SEED Role

"Superoxide dismutase [Mn] (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• superoxide radicals degradation (2/2 steps found)
• ethene biosynthesis III (microbes) (5/7 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

See A0A2M8WAK0 at UniProt or InterPro

Protein Sequence (228 amino acids)

>Ga0059261_1204 Superoxide dismutase (Sphingomonas koreensis DSMZ 15582)
MAIDRRTALSIGLAAGTVSLTGTTLAQPGFVKADFKAKELPFDPTAVPSLSEKLLIGHHA
NNYVGAVKRLGAITAEFAALDPAKAPVFTLNGLKREELIAWNSMILHELYFAGFGRAAAP
PVALAQQIERSFGSFDRWTAEFTGMGKALGGGSGWVLLTWSNRDQRLVNQWAADHSMTLA
DSVPLLALDMYEHAYAMDYGAKVAAYVDAHMKVIDWNEAARRLKRAIA