Protein Info for Ga0059261_1147 in Sphingomonas koreensis DSMZ 15582

Annotation: Bacterial flagellin N-terminal helical region/Bacterial flagellin C-terminal helical region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF00669: Flagellin_N" amino acids 5 to 143 (139 residues), 82.8 bits, see alignment E=2.5e-27 PF00700: Flagellin_C" amino acids 191 to 274 (84 residues), 64.3 bits, see alignment E=1e-21

Best Hits

KEGG orthology group: None (inferred from 54% identity to mmr:Mmar10_1962)

Predicted SEED Role

"Flagellin protein FlaA" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JG70 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Ga0059261_1147 Bacterial flagellin N-terminal helical region/Bacterial flagellin C-terminal helical region (Sphingomonas koreensis DSMZ 15582)
MAFSVNTNAGAMAALQSLNATNKKMDVTQSRINTGLAVSSTKDDSAKYTVAQSLRGDLGG
LNAVSSSLNNAKSVTDTAIAGAEQISDLLNQMKSKAYEAADAGLDAASRTAIDKDFTALK
GQIGTIIKSSEFNNTNLLDNTFTGTKTVAALQSLDVTSTLAVANQSFDTAVDGAITGGIA
TQATAQTMVGTLDTVITAVNTSLSDLGAASRKIEGQLKFTSKLSDVVTTGIGNLVDADLA
KESANLQALQVQQQLGVQALSIANQAPQTILSLFR