Protein Info for Ga0059261_1110 in Sphingomonas koreensis DSMZ 15582

Annotation: flagellar biosynthetic protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 74 (34 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 184 to 210 (27 residues), see Phobius details amino acids 218 to 242 (25 residues), see Phobius details PF00813: FliP" amino acids 47 to 238 (192 residues), 254.8 bits, see alignment E=3.1e-80 TIGR01103: flagellar biosynthetic protein FliP" amino acids 47 to 242 (196 residues), 273.4 bits, see alignment E=5.7e-86

Best Hits

Swiss-Prot: 56% identical to FLIP_CAUVC: Flagellar biosynthetic protein FliP (fliP) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 63% identity to pgv:SL003B_1544)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WAA9 at UniProt or InterPro

Protein Sequence (246 amino acids)

>Ga0059261_1110 flagellar biosynthetic protein FliP (Sphingomonas koreensis DSMZ 15582)
MRRRLLIGGGIAAALMLMFPEPALAQSVLPGGGDGSTSGLAIQLVLMLTVLSLAPGILMT
ITSFTRIVVALSLLRSGLGVPGVPPNPVVISLALFLSFFVMAPTFDAAWKGAMVPYNEGK
ITETQALERASKPFHSFMLKHVRDEDVGLFVQLSGKPAPSRAELPMTTLMPAFMISELRR
AFEIGFLLLLPFLVIDLAVAAVLMAMGMMMLPPATISLPMKIIFFVLVDGWALIAGSLVK
SFGAPG