Protein Info for Ga0059261_1073 in Sphingomonas koreensis DSMZ 15582

Annotation: Uncharacterized iron-regulated membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details PF03929: PepSY_TM" amino acids 9 to 364 (356 residues), 184.3 bits, see alignment E=2.4e-58

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WA82 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Ga0059261_1073 Uncharacterized iron-regulated membrane protein (Sphingomonas koreensis DSMZ 15582)
MSRARILIRRVHLWLGVSLGLLFVLLGLTGSALVFYVEIDAALNRNAIGEARGSVPGWSS
PVWDRALATARQRWPAGDWSFEATGEGGAIPARYYPASEHHGHHAEREMVWFSPDGNRIL
RTEPWGGYVMSWLYELHMHLLAGETGRQIVGWSGVAMLVLLISGIAAWWPRGSWRKALAF
KRKAAPIRRLRDLHKHFGLWSSALLLVLVGTGVLLALPGVKTQVIGTMIATPDPVPAPRS
IASTARQISVAEALTAAHRALPDARLAFTDVPPAGDKPFRIRAQVPGDPHARFPGSFVFV
DQYSGRVLAVHDIRRGNAGTTVSAWIRTLHDGSVGGTPARIVAALLGLIPAVLFGTGLLH
WLRRRRAPHLRTQSRTSSGSIS