Protein Info for Ga0059261_1042 in Sphingomonas koreensis DSMZ 15582

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00106: adh_short" amino acids 9 to 196 (188 residues), 104.6 bits, see alignment E=7.6e-34 PF08659: KR" amino acids 10 to 152 (143 residues), 42.2 bits, see alignment E=1.3e-14 PF13561: adh_short_C2" amino acids 18 to 255 (238 residues), 132 bits, see alignment E=4.2e-42

Best Hits

KEGG orthology group: None (inferred from 82% identity to hdn:Hden_2791)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6J9Q4 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Ga0059261_1042 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Sphingomonas koreensis DSMZ 15582)
MADHGISGKTVLIAGGAKNLGGLIARDLAAHGAKAVAIHYNSAATADAAAETVAAIRAAG
AEAIAIQADLTSAGAMEKLFAHTVNAIGRPDIAINTVGKVLKKPIVEIGEAEYDAMSAVN
AKAAFFFLKEAGRHVADNGKVCTLVTSLLGAYTPFYASYAGTKAPVEHFTRAASKEFGER
GISVTAIGPGPMDTPFFYPAEGPEAVAYHKTAAALSPFTPTGLTHIEDIVPWIRFLVSDG
WWMTGQTILVNGGYTTK