Protein Info for Ga0059261_1034 in Sphingomonas koreensis DSMZ 15582

Annotation: haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF00702: Hydrolase" amino acids 4 to 181 (178 residues), 92.4 bits, see alignment E=1e-29 PF12710: HAD" amino acids 5 to 177 (173 residues), 48.6 bits, see alignment E=2.7e-16 PF13419: HAD_2" amino acids 6 to 187 (182 residues), 106.5 bits, see alignment E=3.8e-34 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 96 to 181 (86 residues), 30.4 bits, see alignment E=4.7e-11 PF13242: Hydrolase_like" amino acids 143 to 210 (68 residues), 52.5 bits, see alignment E=7.5e-18

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 62% identity to sch:Sphch_0295)

Predicted SEED Role

"Similar to phosphoglycolate phosphatase, clustered with ribosomal large subunit pseudouridine synthase C" in subsystem 2-phosphoglycolate salvage

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6J9N1 at UniProt or InterPro

Protein Sequence (219 amino acids)

>Ga0059261_1034 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E (Sphingomonas koreensis DSMZ 15582)
MNRLAVFDCDGTLVDSQANICRAMEACFAQHRLEPPGRDSIRRIVGLSLVPAIAALLPEA
EARQHELMAEDYKRAFHAMRTDRALDPEPLFDGIVEAIDALDEAGWLLGVATGKSDRGLA
LILEHHGLTRRFVTLQTADRHPSKPHPSMLELAIAEAGAAPHTTAMIGDTSFDIAMAINA
GTHAVGVAWGYHEPHELTAAGAHRVSDTARDLPAMLEAL