Protein Info for Ga0059261_0997 in Sphingomonas koreensis DSMZ 15582

Annotation: Enterochelin esterase and related enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 672 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00756: Esterase" amino acids 43 to 297 (255 residues), 88.7 bits, see alignment E=5.2e-29 PF04187: Cofac_haem_bdg" amino acids 332 to 420 (89 residues), 31.4 bits, see alignment E=1.9e-11

Best Hits

Predicted SEED Role

"putative esterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WA39 at UniProt or InterPro

Protein Sequence (672 amino acids)

>Ga0059261_0997 Enterochelin esterase and related enzymes (Sphingomonas koreensis DSMZ 15582)
MAGLRWLWALALLMVAASAAVPAQAAPRLIRHAAFQSAEVSPRDVTVWLPDGYRADGPPL
PVIYMQDGQNLHEGSRAFGGQSWGVGETAARLIREGKIPPVIIVGIDNSATRGRDYLPQR
IYDLLPEASRTMIRDGWGGAPQSDAYLNFLVRELKPFIDKQYRTRTDRASTFVMGSSMGG
LISLYAQVQYPEVFGGSASLSMHWLLGNSGAPLPEPPLYTRQVLRAFETWIALAHLSPNR
HRIYVDRGTETLDARYTPYTAPFETFMRRAGWGDSFTSRIYPGTDHSEKSWSARLADPLT
FLLAPGDGAEAQTEAARLAQLRAAQAPDDYLLAKFRSADIVLLGEDHAVKQSIAFVANAI
PKLYAAGVTNLVMEFGAEEDQAALDRLVTAPAYDAAAARQLMFNYNVMWSWQDYRDLYRA
VWAFNRTLPRGRPPFRIVNMSYVFDWSGFSGTRTPETLRQVFPRGMVDQFRAERIAREVL
DKDQKALVLTGTLHAFTRFAAGQTQSDGDGFCQRTANALGNRLHAAYGNRITNVMLHQSL
PALPGRRAVFEQPGDGAVERIIRLNGNRPAGFDLRGAPMGSIRDYSYYGICDRDFTLADL
FDGYIFLAPFRDLRAATPDTGFVDEANLERAIEQFPDPDWAPRPANLAQARAHLLDMAKQ
IDARYAALAGTD