Protein Info for Ga0059261_0940 in Sphingomonas koreensis DSMZ 15582

Annotation: glutamyl-tRNA synthetase, bacterial family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 PF00749: tRNA-synt_1c" amino acids 32 to 334 (303 residues), 305.8 bits, see alignment E=2.8e-95 TIGR00464: glutamate--tRNA ligase" amino acids 33 to 489 (457 residues), 487.2 bits, see alignment E=2.7e-150 PF19269: Anticodon_2" amino acids 349 to 488 (140 residues), 114.6 bits, see alignment E=5.2e-37

Best Hits

Swiss-Prot: 69% identical to SYE2_NOVAD: Glutamate--tRNA ligase 2 (gltX2) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K01885, glutamyl-tRNA synthetase [EC: 6.1.1.17] (inferred from 69% identity to nar:Saro_2031)

Predicted SEED Role

"Glutamyl-tRNA synthetase (EC 6.1.1.17)" in subsystem Heme and Siroheme Biosynthesis or tRNA aminoacylation, Glu and Gln (EC 6.1.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.17

Use Curated BLAST to search for 6.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W9T8 at UniProt or InterPro

Protein Sequence (496 amino acids)

>Ga0059261_0940 glutamyl-tRNA synthetase, bacterial family (Sphingomonas koreensis DSMZ 15582)
VLGALAAELAIDHSFWEQARLGATSEPATGTQIVTRFAPSPTGFLHIGGARTALFNWLFA
RHHGGKFLLRIEDTDRARSTDAAIEAILDGMRWLGLDWDGDEVYQFARADRHAEVAHAML
ESGHAYRCWMSQEEIAAQREEAQAAKKPYRIRSPWRDRTDGPLDQPHVVRIRAPREGATT
IRDAVQGEVTVQNAELDDMILLRSDGTPTYMLAVVVDDHDMGVTHVIRGDDHLNNAFRQL
LIIHAMDWAEPVYAHIPLIHGADGAKLSKRHGALGVDAYRDELGVLPEALFNHLLRLGWG
HGDDEIIDRAQAVEWFDLSGVGKSPSRFDLKKLDSLNGHYIRAADDARLAQLAAPFLPFE
ASPQQIDLLQRSMHALKPRAANLLEIADGSAFLFRTRPLEMDADAQALLGDDAKAILHSL
HTALDALADWNTEALETAVRQVAESGGVKLGAAAQPLRAALTGRRTSPGIFDVLVLLGRE
ESLGRIADQMAAPSGS