Protein Info for Ga0059261_0861 in Sphingomonas koreensis DSMZ 15582

Annotation: Acyl-CoA dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF02771: Acyl-CoA_dh_N" amino acids 15 to 131 (117 residues), 58.9 bits, see alignment E=9.2e-20 PF02770: Acyl-CoA_dh_M" amino acids 135 to 228 (94 residues), 73.9 bits, see alignment E=1.4e-24 PF00441: Acyl-CoA_dh_1" amino acids 240 to 397 (158 residues), 59.4 bits, see alignment E=7.2e-20

Best Hits

KEGG orthology group: None (inferred from 74% identity to eli:ELI_00295)

Predicted SEED Role

"Acyl-CoA dehydrogenase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W9M9 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Ga0059261_0861 Acyl-CoA dehydrogenases (Sphingomonas koreensis DSMZ 15582)
MATLAEPATGTGLDQFRTEVREWLAANFPASLKGKDNTMSAVEGPTEETPDQAAWRKAMG
EKGWGVPTWPREYGGGGLSRAEAKVLADEMAKAGAWNPIGGMGVMMFGPTLLEYGNEAQK
REHIPAIAKGEVRWCQGYSEPNAGSDLANLQCFAEDKGDHYLVNGQKTWTSGGQWADKCF
CIVRTDKTQKQGGITFLLIDMDTPGVEVKPIQMISGMSPFCETFFTNVKVPKENRVGEEG
QGWTIGKRLLQHERTNLSGGGSRLMPSGPSLADIAKNYVGADAEGRVADPDLRARIAKWE
MDWRAFLLTAMRVQAESKAAGGVSEVSSILKTVGTKLGQERAELLIEIQGHEGLGWEGEG
FSEAQLKGTRAWLFGKATTIYGGSTEIQNNIIAKRILGMLDHQ