Protein Info for Ga0059261_0819 in Sphingomonas koreensis DSMZ 15582

Annotation: Holliday junction DNA helicase subunit RuvB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF05496: RuvB_N" amino acids 21 to 179 (159 residues), 265.5 bits, see alignment E=5.2e-83 TIGR00635: Holliday junction DNA helicase RuvB" amino acids 24 to 327 (304 residues), 445.1 bits, see alignment E=5.5e-138 PF06068: TIP49" amino acids 26 to 82 (57 residues), 24 bits, see alignment E=7.5e-09 PF00004: AAA" amino acids 56 to 178 (123 residues), 71.1 bits, see alignment E=4.4e-23 PF07728: AAA_5" amino acids 97 to 173 (77 residues), 26.6 bits, see alignment E=1.8e-09 PF17864: AAA_lid_4" amino acids 182 to 255 (74 residues), 103.2 bits, see alignment E=1.8e-33 PF05491: RuvB_C" amino acids 257 to 326 (70 residues), 89.2 bits, see alignment E=4.7e-29

Best Hits

Swiss-Prot: 88% identical to RUVB_SPHWW: Holliday junction ATP-dependent DNA helicase RuvB (ruvB) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K03551, holliday junction DNA helicase RuvB (inferred from 88% identity to swi:Swit_2138)

MetaCyc: 61% identical to Holliday junction branch migration complex subunit RuvB (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Holliday junction DNA helicase RuvB" in subsystem DNA-replication or RuvABC plus a hypothetical

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W9J1 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Ga0059261_0819 Holliday junction DNA helicase subunit RuvB (Sphingomonas koreensis DSMZ 15582)
MTDSDRILTASRRPEDVDAALRPKSLDEFVGQRAARDNLRVFIDAARTRGDALDHVLFFG
PPGLGKTTLAQIIAKEMGVGFRATSGPVIAKSGDLAALLTNLEDGDVLFIDEIHRLNPAV
EEVLYPAMEDRALDLMIGEGPSARSVRIDLPRFTLVGATTRQGLLTTPLRDRFGIPVRLQ
FYTVEELTRVVTRAAGLLDLGIAQDGAAEIARRSRGTPRIAGRLLRRVRDFANVAGESVV
HARAADAALNRLEVDALGLDAMDRRYLTMIADIYRGGPVGVETLAAGLSEPRDTIEEVIE
PYLIQIGMIARTARGRCLNAAGWKHLGLNPPAGSQDGLFDGK