Protein Info for Ga0059261_0787 in Sphingomonas koreensis DSMZ 15582

Annotation: Mg chelatase-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR00368: Mg chelatase-like protein" amino acids 7 to 496 (490 residues), 509 bits, see alignment E=6.4e-157 PF13541: ChlI" amino acids 20 to 139 (120 residues), 126.8 bits, see alignment E=1.4e-40 PF01078: Mg_chelatase" amino acids 188 to 392 (205 residues), 311.1 bits, see alignment E=9.3e-97 PF00158: Sigma54_activat" amino acids 198 to 344 (147 residues), 22 bits, see alignment E=3.4e-08 PF07728: AAA_5" amino acids 211 to 347 (137 residues), 27.4 bits, see alignment E=9.3e-10 PF00493: MCM" amino acids 281 to 347 (67 residues), 31.6 bits, see alignment E=2.8e-11 PF13335: Mg_chelatase_C" amino acids 401 to 496 (96 residues), 102.2 bits, see alignment E=5.9e-33

Best Hits

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 82% identity to sch:Sphch_1837)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W9D1 at UniProt or InterPro

Protein Sequence (502 amino acids)

>Ga0059261_0787 Mg chelatase-related protein (Sphingomonas koreensis DSMZ 15582)
MVASVSTVAYLGLEARAVEVQCNLVPGLPNFVVVGLPDKAVAESRERVRAAMAAIGLALP
PKRVILNLSPADLPKEGSHFDLPIALALLGAMGVVDAETLSEHVFVGELGLDGRIAPSPG
VLLAALHAAETGKGLVCPVAQGPEAAWAGTTGVIAAPDLIGLINHFKGQQLLGAPQAGEA
EEASLGPDLRQVKGQETAKRALEIAAAGGHNLLMVGPPGAGKSLMASCLPGILPPLDASE
ALEVSMVASVAGTLQGGKLTRMRPFRSPHHSASMAALTGGGLKVKPGEVSMAHLGVLFLD
ELPEFQRAVLDSLRQPLESGTVSVARANAHVTFPARVQLVAAMNPCRCGHLGDPALACAR
APKCAADYQAKVSGPLLDRIDLHVDVQPVTAADLVLPPPAEGSAEVAARVAAARKVQAAR
YNGSGTRTNAEADGPVLDDAATPDEPGRKLLAQAAEAMRMSARGYTRVLRVARTIADLAQ
SETVGRIHVAEALSYRRQPPRS