Protein Info for Ga0059261_0751 in Sphingomonas koreensis DSMZ 15582

Annotation: DNA repair protein RadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 TIGR00416: DNA repair protein RadA" amino acids 1 to 433 (433 residues), 517.5 bits, see alignment E=1.5e-159 PF18073: Zn_ribbon_LapB" amino acids 8 to 35 (28 residues), 46.7 bits, see alignment (E = 6.1e-16) PF06745: ATPase" amino acids 73 to 142 (70 residues), 45.9 bits, see alignment E=1.5e-15 PF13481: AAA_25" amino acids 76 to 222 (147 residues), 63.6 bits, see alignment E=6.1e-21 PF13541: ChlI" amino acids 345 to 430 (86 residues), 32.4 bits, see alignment E=2.3e-11 PF05362: Lon_C" amino acids 353 to 430 (78 residues), 26.1 bits, see alignment E=1.8e-09

Best Hits

Swiss-Prot: 62% identical to RADA_BRUA2: DNA repair protein RadA (radA) from Brucella abortus (strain 2308)

KEGG orthology group: K04485, DNA repair protein RadA/Sms (inferred from 77% identity to sch:Sphch_0091)

Predicted SEED Role

"DNA repair protein RadA" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W9F0 at UniProt or InterPro

Protein Sequence (455 amino acids)

>Ga0059261_0751 DNA repair protein RadA (Sphingomonas koreensis DSMZ 15582)
MAKLQKRYVCQQCGSVSSKWAGQCADCGDWNTLVEDAGAVVTPFQAKHNLQGGGRMISMS
GLDTDVPLPDRMPTGIAELDRALGGGFVEASATLIGGDPGIGKSTLLLQAAAKMALAGHG
VAYVSGEEAADQVRLRARRLGLGNAPVQLAAATSVRDILTTLGGTAPPRLLIIDSIQTMH
SDLIEGAPGTVSQVRASAQELIRFAKERGTAVVLVGHVTKDGSLAGPRVLEHMVDTVLAF
EGERSHQYRILRAVKNRFGGTDEIGVFSMQSEGLAEVGNPSSLFLTSRDESVTGTVVFPA
LEGTRPVLVEIQALVVRLASGATPRRAVVGWDSGRLAMILAVLEARCGLSFSTSEVYLNI
AGGYRVQDPAADLAVAAALVSALSERPVAPDAVVFGEIALSGEVRPVAHGALRLKEAGKL
GFTRALVPAAQGKEGAVALTGFKSLGGFVEHMLGR