Protein Info for Ga0059261_0686 in Sphingomonas koreensis DSMZ 15582
Annotation: haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED/haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01560, 2-haloacid dehalogenase [EC: 3.8.1.2] (inferred from 59% identity to sch:Sphch_2868)Predicted SEED Role
"Hydrolase, haloacid dehalogenase-like family"
MetaCyc Pathways
- 2-chloroacrylate degradation I (2/3 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.8.1.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1L6JAJ1 at UniProt or InterPro
Protein Sequence (205 amino acids)
>Ga0059261_0686 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED/haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E (Sphingomonas koreensis DSMZ 15582) MGGVRAAIFDIGNVLFTWHPRFLYERLIGDDQALAAFLDEVVTIEWHFQHDEGRDFADTS AELTALYPQHADLIAAWKTRFNESIGGPVPGMHDLVADLDSAGVPLFAITNFSHEFFPPF RAEWTGLFDRFRDIVVSGDEKLVKPDPAIYHLSLARFGLEPHEAVFIDDNEANILSARAL GIRSVHFKDVESTRREIVEAGLLAA