Protein Info for Ga0059261_0686 in Sphingomonas koreensis DSMZ 15582

Annotation: haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED/haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 PF00702: Hydrolase" amino acids 4 to 181 (178 residues), 65 bits, see alignment E=1.8e-21 PF13419: HAD_2" amino acids 62 to 185 (124 residues), 55.4 bits, see alignment E=1.3e-18 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 89 to 181 (93 residues), 24.1 bits, see alignment E=4.2e-09 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 123 to 186 (64 residues), 56.6 bits, see alignment E=3.3e-19 PF13242: Hydrolase_like" amino acids 144 to 189 (46 residues), 26.4 bits, see alignment 7.9e-10

Best Hits

KEGG orthology group: K01560, 2-haloacid dehalogenase [EC: 3.8.1.2] (inferred from 59% identity to sch:Sphch_2868)

Predicted SEED Role

"Hydrolase, haloacid dehalogenase-like family"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JAJ1 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Ga0059261_0686 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED/haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E (Sphingomonas koreensis DSMZ 15582)
MGGVRAAIFDIGNVLFTWHPRFLYERLIGDDQALAAFLDEVVTIEWHFQHDEGRDFADTS
AELTALYPQHADLIAAWKTRFNESIGGPVPGMHDLVADLDSAGVPLFAITNFSHEFFPPF
RAEWTGLFDRFRDIVVSGDEKLVKPDPAIYHLSLARFGLEPHEAVFIDDNEANILSARAL
GIRSVHFKDVESTRREIVEAGLLAA