Protein Info for Ga0059261_0664 in Sphingomonas koreensis DSMZ 15582

Annotation: pseudouridine synthase, RluA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 TIGR00005: pseudouridine synthase, RluA family" amino acids 17 to 315 (299 residues), 330 bits, see alignment E=6.9e-103 PF00849: PseudoU_synth_2" amino acids 93 to 250 (158 residues), 108.9 bits, see alignment E=1.4e-35

Best Hits

Swiss-Prot: 65% identical to RLUD_ZYMMO: Ribosomal large subunit pseudouridine synthase D (rluD) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K06180, ribosomal large subunit pseudouridine synthase D [EC: 5.4.99.12] (inferred from 72% identity to swi:Swit_0061)

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase D (EC 4.2.1.70)" in subsystem Ribosome biogenesis bacterial (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W945 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Ga0059261_0664 pseudouridine synthase, RluA family (Sphingomonas koreensis DSMZ 15582)
MVPGVSTLEARIADAADGWRLDRALADALPTLSRERIKALISTGNVTGPDGQVRDPKRKA
PGGALFRIDVPEPAAAHNEPQDIELKIVFEDEHLIVIDKQAGLVVHPAAGNFDGTLVNAL
LHHCQGSLSGIGGVARPGIVHRIDKDTSGLMVAAKTDRAHVGLARQFKAHSIDRRYKAIV
SGRPKTGSGTVDAPLARSPQNRKKMAIVAGGKRAVTHWRLHELHELHEAALVECRLETGR
THQVRVHMASIGHPLIGDPVYGRTKKEHRELLETLGFHRQALHAAHLGFIHPIDSRALAF
ESQMPADMQELFDQLVV