Protein Info for Ga0059261_0594 in Sphingomonas koreensis DSMZ 15582

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF16576: HlyD_D23" amino acids 79 to 295 (217 residues), 87.3 bits, see alignment E=1.4e-28 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 90 to 374 (285 residues), 142.4 bits, see alignment E=7.9e-46 PF13533: Biotin_lipoyl_2" amino acids 91 to 125 (35 residues), 30.4 bits, see alignment 4.1e-11 PF13437: HlyD_3" amino acids 93 to 139 (47 residues), 22.5 bits, see alignment 2.4e-08 amino acids 200 to 295 (96 residues), 52.8 bits, see alignment E=8.9e-18

Best Hits

Swiss-Prot: 34% identical to NCCB_ALCXX: Nickel-cobalt-cadmium resistance protein NccB (nccB) from Alcaligenes xylosoxydans xylosoxydans

KEGG orthology group: None (inferred from 64% identity to sal:Sala_2568)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W8U5 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Ga0059261_0594 RND family efflux transporter, MFP subunit (Sphingomonas koreensis DSMZ 15582)
MKTLMIGAAAPLVLLLAGCGGTETAANDAAEAPDNKPAPANGQEAHADEGMITLTAQQIR
TAGIEIVRPSVSGGGTLVRPATIEGDPQGTQVVSAAIGGRVVALNYNLGQPVRRGQVLAV
IESREAASIRAEVEAAQARAALASSNLAREERLFKLRVSPERDVVAARTAATEASIELRL
ARQQLSAAGVAGGGLNRIGVAAPIAGLVTARPVTLGQTVAADAELFRVSNLSQVAVTVSL
SPAEAAQVKAGAPVEISSGGRRAAARVSFVSPVLDEATRLVTVIALIDNRAGEWRVGEAV
TAAMQLPGAGAGSVTVPASAIQTVEERPVVFVRTPNGFKATPVTPGARGSGTVAVTAGLT
GREEIAGQGSFTLKAELGKGEAEHGGH