Protein Info for Ga0059261_0578 in Sphingomonas koreensis DSMZ 15582

Annotation: Major Facilitator Superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details amino acids 275 to 298 (24 residues), see Phobius details amino acids 318 to 341 (24 residues), see Phobius details amino acids 350 to 373 (24 residues), see Phobius details amino acids 379 to 399 (21 residues), see Phobius details PF07690: MFS_1" amino acids 10 to 298 (289 residues), 70.9 bits, see alignment E=4.7e-24

Best Hits

KEGG orthology group: None (inferred from 44% identity to swd:Swoo_1438)

Predicted SEED Role

"Predicted trehalose permease, MFS family, FucP subfamily" in subsystem Trehalose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W8T5 at UniProt or InterPro

Protein Sequence (408 amino acids)

>Ga0059261_0578 Major Facilitator Superfamily (Sphingomonas koreensis DSMZ 15582)
MSRIRVIIALALTYAVLGILMNSVGVVILQSIRHFDATKPMGSTLEACKDLSVVAASFLL
ATRVPAFGYRRALIGVMTLIGIACLLASFASGFVAMQALFVATGLSFGIAKVATYSSIGL
LARDPADHASITGLIEGVFMVGLLVGVWLFGWFVGADTTGSDWLHVYWVLGGACLALALL
WFATPLDERGAVATDGAETAHWSEMLRLAALPASITVLAGLFLYVLVEQSVGTWLPTFNN
EVLHLPAAMSVQMTSIFVGALAVGRLASGVVLRRVAWLPALLGCLGCIAVLIVVSLPLAS
GVTPRPDTGWFDAPAAAYLFPLLGVFLAPIYPTLCSVALSALPRHRHAAMMGLIVIFSAL
GGTLGSFITGLLFQRLPGALAFYFTLIPIAMIAVALPVIRKRQAVAAT