Protein Info for Ga0059261_0508 in Sphingomonas koreensis DSMZ 15582

Annotation: 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF01557: FAA_hydrolase" amino acids 26 to 223 (198 residues), 187.7 bits, see alignment E=1.2e-59

Best Hits

KEGG orthology group: None (inferred from 73% identity to npp:PP1Y_AT1633)

MetaCyc: 55% identical to 3-fumarylpyruvate hydrolase (Bradyrhizobium sp. JS329)
RXN-10445 [EC: 3.7.1.20]

Predicted SEED Role

"Fumarylacetoacetate hydrolase family protein" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W8L7 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Ga0059261_0508 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) (Sphingomonas koreensis DSMZ 15582)
VSDLFQPQPPVYAATSDGNRFPVRRLFCIGRNYAAHAREMGRDPDREPPFFFTKWAETVV
PGGTTIAYPPETANFHYEAELVVAIGRGGRNIPAADAAAHIYGFATGLDMTRRDLQLVAR
EQGRPWDTGKNVEQSSPLGLIHPIAETGPLTGGAIRLTVNGTVKQDADLADLIWPVDEVI
AYVSRFYRLEPGDLIYTGTPAGVGAVVEGDRIVVTIDGLTPCEILIGPAAAA