Protein Info for Ga0059261_0480 in Sphingomonas koreensis DSMZ 15582

Annotation: Calcineurin-like phosphoesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF16656: Pur_ac_phosph_N" amino acids 34 to 134 (101 residues), 74.9 bits, see alignment E=6.1e-25 PF00149: Metallophos" amino acids 143 to 341 (199 residues), 63 bits, see alignment E=5.3e-21

Best Hits

Predicted SEED Role

"purple acid phosphatase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W8J4 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Ga0059261_0480 Calcineurin-like phosphoesterase (Sphingomonas koreensis DSMZ 15582)
MRPILALALCSLALPTLSAAQEAPPALAPASVAPERIILNLTARPATEMAVTWRSAPGSA
GVVQFARATAGPDFVKAPQQIAATTDDATLDVQEQAGFRAAYHSAVMTGLEPDSVYAYRV
GDGRNWSEWFQFRTAAATPRPFRFIYMGDMQNAILAEASRTLRMAFRQAGDAAFVIHAGD
LVNRHAADREWGEWFAAGGFLYAQTPQMPTPGNHEYVKDPAARAGSSLTGQWRRQFTLPD
NGPTAVPEGTETNWYTDYQGLRLISVDAPQLDRNEAGRAATIAWLDGLLARNPNRWTVIF
LHFPLFSSDPDRDNPKVRTALKPLIDKYKVDLVLQGHDHGYARGAVGPHGPAADDRGSTY
VVAVAGPKMYEVGKLDWARKTASRTQSYQVIDVTPTQLSYRAYTATGEPLDSVTLRKR