Protein Info for Ga0059261_0470 in Sphingomonas koreensis DSMZ 15582

Annotation: copper-resistance protein, CopA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR01480: copper-resistance protein, CopA family" amino acids 4 to 575 (572 residues), 825.2 bits, see alignment E=1.5e-252 PF07732: Cu-oxidase_3" amino acids 62 to 164 (103 residues), 116.8 bits, see alignment E=9.2e-38 PF00394: Cu-oxidase" amino acids 176 to 335 (160 residues), 85.6 bits, see alignment E=6.1e-28 PF07731: Cu-oxidase_2" amino acids 456 to 577 (122 residues), 107.1 bits, see alignment E=9.5e-35

Best Hits

KEGG orthology group: None (inferred from 63% identity to ccr:CC_0964)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W8J1 at UniProt or InterPro

Protein Sequence (582 amino acids)

>Ga0059261_0470 copper-resistance protein, CopA family (Sphingomonas koreensis DSMZ 15582)
MTQLLERRMLLRAGALGAAGVSLSSLFPAWAQSGSPGILSTLPTLTGEDIHLKIARSRYL
VGGRAGRAITLNGVLPAPLVRLREGQNVRLHVENTLDEETSIHWHGLILPFQMDGVPGVS
FPGIKARSLFTYEFPVKQSGTYWYHSHSGLQEQLGHYGPIVIDPAGADPIGYDREHVIVL
SDWTFLDPHQLFNKLKQEGGYFNRQKQTLAGMIAGGPGERLSPSERAKWGKMRMDPADIA
DVSATTYTYLINGHGPQENWTGLFRPGERVRLRIINASSMSIFNIRIPGLKLTVVGADGQ
NVRPVEVDEFQIGTAETYDVIVRPDEDKAYSVVAESLDRSGMGCATLAPRPGMVAAIPPL
RERPTLTMKDMGMGGMDHGAHGAAAGGAAGAMDHGAMSMRDKSKVPESVTVGVGVDAIAF
SPVDRTGDPGIGLDNVGHKVLTYRDLISLTPNPDPRPPARTIEIHLTGNMERFMWSFDGK
KYSDGVEPIRFERNERARITLINHTMMTHPIHLHGHFFEVVNGHTGRQPLKHTINVLPGG
KASFDLTADAPGDWAFHCHLLLHMHAGMFRVVTVRPHAGEGA