Protein Info for Ga0059261_0456 in Sphingomonas koreensis DSMZ 15582

Annotation: Sterol desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 164 to 193 (30 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 110 to 243 (134 residues), 77.1 bits, see alignment E=8.9e-26

Best Hits

KEGG orthology group: None (inferred from 56% identity to mmr:Mmar10_2318)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W8K3 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Ga0059261_0456 Sterol desaturase (Sphingomonas koreensis DSMZ 15582)
MRTLAATLYAPLFFLGFVGMTCWLLAAGHSPFWLLPLLLVAIAVSGTLERLIPWDPVWNK
DHGDTARDITHALVNEASNIVSILAIPLLGALLPTSGLWPSHWSFVAQLALAIGLADLGI
TLAHYASHKSEWLWRLHAPHHSVERMYGFNGLMKHPLHQAIEMLAGLSPLLLMGLPQNIA
WALAVAVSIQLMLQHSNVDMRIGLLRYVWAIAPAHRFHHIRSAREGDVNFGLFTSLWDVL
LGTARFSGPPIRAGDIGIDGRPDYPRGYAAQLAEPFTGR