Protein Info for Ga0059261_0425 in Sphingomonas koreensis DSMZ 15582

Annotation: 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 PF00111: Fer2" amino acids 11 to 86 (76 residues), 55 bits, see alignment E=9.6e-19 PF00970: FAD_binding_6" amino acids 112 to 200 (89 residues), 35.5 bits, see alignment E=1.6e-12 PF00175: NAD_binding_1" amino acids 213 to 313 (101 residues), 69.8 bits, see alignment E=4.7e-23

Best Hits

KEGG orthology group: K00523, CDP-4-dehydro-6-deoxyglucose reductase [EC: 1.17.1.1] (inferred from 65% identity to rhi:NGR_b07390)

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W8D5 at UniProt or InterPro

Protein Sequence (353 amino acids)

>Ga0059261_0425 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases (Sphingomonas koreensis DSMZ 15582)
VNGIVVTRTVHIRQTGRPIAVGDKQTILAAALDAGVAFPHGCRSGRCGACKSRLLSGEVD
LLAHTRFALTAEEKAQGLILACRAQPLTDIEVAWLGEAEIIEHPVRSLKAEVVALDSATH
DINLVRVRVAGEPLVFTAGQYAQLSAAGAPTRDYSMANVPGEEDLEFYIRHIPGGKASER
IATHLAVGDTLTLRGPFGSAYLREGHTGPILAVAGGSGLAPIKAIVETALEKGLRQPIHL
YFGARRRADLYLVDHFERLAAAHANFHFEPVLSRESDAGAGRAGFVTDAIAADFTDLDGW
KAYLAGPPAMIDTAGPLLKARGLASEDFHADIFFTPEPPLREDLRQTTEGAAS