Protein Info for Ga0059261_0361 in Sphingomonas koreensis DSMZ 15582

Annotation: conserved hypothetical protein, YceG family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF02618: YceG" amino acids 39 to 312 (274 residues), 273.2 bits, see alignment E=1.4e-85 TIGR00247: conserved hypothetical protein, YceG family" amino acids 139 to 313 (175 residues), 173.4 bits, see alignment E=3.5e-55

Best Hits

KEGG orthology group: K07082, UPF0755 protein (inferred from 63% identity to swi:Swit_0090)

Predicted SEED Role

"FIG004453: protein YceG like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W884 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Ga0059261_0361 conserved hypothetical protein, YceG family (Sphingomonas koreensis DSMZ 15582)
MLRKLGCLGVIAVLVIGAAAFWAANQWGGAGPGKANVTVEVPAGATMRSAAEAMEKAGAI
ESADTFLWMARIFGDDAPVQAGEYRVPAGISQADILKMLQGGRTLQRFVMIPEGMPSILV
HERLAAAPQLGGKTAVPEEGSILPDSYSYNRGESRQAVLDRMQAAMKKYLAQAWAKRKPG
IAVSTPEQALILASIVEKETGKAEERRMVAGVYSNRLKRGMPLQADPTVIYPVTKGKPLG
RRILRSELQDKNGYNTYASAGLPIGPIANPGRASIDAVLDPAETNALYFVADGTGGHIFA
DTLEQHNANVQKWYALRRARGEM