Protein Info for Ga0059261_0356 in Sphingomonas koreensis DSMZ 15582

Annotation: Entner-Doudoroff aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01081: Aldolase
  • amino acids 3 to 184 (182 residues), 246.7 bits, E=6.8e-78
• TIGR01182: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
  • amino acids 4 to 197 (194 residues), 232.9 bits, E=1.1e-73

Best Hits

Swiss-Prot: 58% identical to ALKH_ZYMMO: KHG/KDPG aldolase (eda) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K01625, 2-dehydro-3-deoxyphosphogluconate aldolase / 4-hydroxy-2-oxoglutarate aldolase [EC: 4.1.2.14 4.1.3.16] (inferred from 71% identity to nar:Saro_2568)

MetaCyc: 53% identical to KHG/KDPG aldolase (Escherichia coli K-12 substr. MG1655)
RXN-13990 [EC: 4.1.3.42]; 2-dehydro-3-deoxy-phosphogluconate aldolase. [EC: 4.1.3.42, 4.1.2.14, 4.1.2.55]; Malate dehydrogenase (oxaloacetate-decarboxylating). [EC: 4.1.3.42, 4.1.2.14, 4.1.2.55, 1.1.1.38, 1.1.1.40, 1.1.1.83, 4.1.1.112]

Predicted SEED Role

"4-Hydroxy-2-oxoglutarate aldolase (EC 4.1.3.16) @ 2-dehydro-3-deoxyphosphogluconate aldolase (EC 4.1.2.14)" (EC 4.1.2.14, EC 4.1.3.16)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (9/9 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (8/8 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (12/14 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• superpathway of vanillin and vanillate degradation (9/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• glyoxylate cycle (6/6 steps found)
• methylgallate degradation (6/6 steps found)
• gluconeogenesis I (11/13 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (8/9 steps found)
• gluconeogenesis III (10/12 steps found)
• Entner-Doudoroff shunt (2/2 steps found)
• malate/L-aspartate shuttle pathway (2/2 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (4/5 steps found)
• D-galacturonate degradation I (4/5 steps found)
• methylaspartate cycle (14/19 steps found)
• D-fructuronate degradation (3/4 steps found)
• reductive TCA cycle I (8/11 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (5/7 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
• incomplete reductive TCA cycle (5/7 steps found)
• superpathway of β-D-glucuronosides degradation (5/7 steps found)
• D-galactonate degradation (2/3 steps found)
• superpathway of hexuronide and hexuronate degradation (7/10 steps found)
• trans-4-hydroxy-L-proline degradation I (3/5 steps found)
• syringate degradation (8/12 steps found)
• chitin deacetylation (2/4 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
• 3,6-anhydro-α-L-galactopyranose degradation (4/7 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (9/14 steps found)
• D-glucosaminate degradation (1/3 steps found)
• L-carnitine degradation II (1/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (11/17 steps found)
• formaldehyde assimilation I (serine pathway) (8/13 steps found)
• reductive TCA cycle II (7/12 steps found)
• gentisate degradation II (1/4 steps found)
• L-glucose degradation (3/7 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (12/31 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Carbon fixation in photosynthetic organisms
• Glyoxylate and dicarboxylate metabolism
• Pentose and glucuronate interconversions
• Pentose phosphate pathway
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.40

Use Curated BLAST to search for 1.1.1.38 or 1.1.1.40 or 1.1.1.83 or 4.1.1.112 or 4.1.2.14 or 4.1.2.55 or 4.1.3.16 or 4.1.3.42

Sequence Analysis Tools

See A0A2M8W869 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Ga0059261_0356 Entner-Doudoroff aldolase (Sphingomonas koreensis DSMZ 15582)
VTIETIMRTSAVIPVLVIEDAATARPLAEALVAGGLKVLEVTMRTAAALDAIREMKQVPG
AIVGAGTVVNTDQFAQVMDAGAEFIVSPGLTERLGQVIVQSGVPFLPGVANAGDIMRGYD
LGLRHFKFFPAETSGGLKALKALAGPFYEAKFCPTGGISPATAPDWLGFDPVLCVGGSWV
TPKGASYAEVEALARDAAGLAR