Protein Info for Ga0059261_0353 in Sphingomonas koreensis DSMZ 15582

Annotation: 6-phosphogluconolactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01198: 6-phosphogluconolactonase
  • amino acids 10 to 226 (217 residues), 157.9 bits, E=1.6e-50
• PF01182: Glucosamine_iso
  • amino acids 12 to 224 (213 residues), 162.8 bits, E=5.9e-52

Best Hits

KEGG orthology group: K01057, 6-phosphogluconolactonase [EC: 3.1.1.31] (inferred from 66% identity to swi:Swit_2888)

Predicted SEED Role

"6-phosphogluconolactonase (EC 3.1.1.31), eukaryotic type" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 3.1.1.31)

MetaCyc Pathways

• Entner-Doudoroff pathway I (9/9 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• pentose phosphate pathway (7/8 steps found)
• heterolactic fermentation (14/18 steps found)
• pentose phosphate pathway (oxidative branch) I (2/3 steps found)
• formaldehyde oxidation I (3/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.31

Sequence Analysis Tools

See A0A1L6JCG2 at UniProt or InterPro

Protein Sequence (235 amino acids)

>Ga0059261_0353 6-phosphogluconolactonase (Sphingomonas koreensis DSMZ 15582)
MAEEIEWWEYEEAEEWVDALAGDIGFIIESAIDARGGAVIALAGGKTPAPVYEKLAAAKI
DWKRVTIVPTDDRIVPLGDALSNVTGLGKTFIPKGARVIPLVSEKADDYKAAGRAADARL
ADFHWPLDLVLLGMGADGHTASIFPGPDFDEALNGPKERRALGVMPDPLPPEAPVARVTL
SGAAIANAKSLMVAITGAEKRKVLETAIAQGASSAYPIGRVLAETELPVDVHWLE