Protein Info for Ga0059261_0352 in Sphingomonas koreensis DSMZ 15582

Annotation: glucose-6-phosphate 1-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00871: glucose-6-phosphate dehydrogenase
  • amino acids 8 to 484 (477 residues), 550.8 bits, E=1.4e-169
• PF00479: G6PD_N
  • amino acids 10 to 183 (174 residues), 165.8 bits, E=1.7e-52
• PF02781: G6PD_C
  • amino acids 185 to 484 (300 residues), 394.7 bits, E=2.3e-122

Best Hits

Swiss-Prot: 64% identical to G6PD_ZYMMO: Glucose-6-phosphate 1-dehydrogenase (zwf) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 72% identity to nar:Saro_1893)

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• L-lysine biosynthesis II (8/9 steps found)
• pentose phosphate pathway (7/8 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (7/8 steps found)
• heterolactic fermentation (14/18 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• cytosolic NADPH production (yeast) (4/5 steps found)
• pentose phosphate pathway (oxidative branch) I (2/3 steps found)
• formaldehyde oxidation I (3/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Glutathione metabolism
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.49

Sequence Analysis Tools

See A0A2M8W868 at UniProt or InterPro

Protein Sequence (485 amino acids)

>Ga0059261_0352 glucose-6-phosphate 1-dehydrogenase (Sphingomonas koreensis DSMZ 15582)
MRQPFGKLLLFGATGDLSQRMLIPSLYGLHADGLLPQDLTITGTARSTLSDAEFRDFAAK
ALDTHLPEDRKDAGAIAAFLDRLQYQQLDASDLGGYAALAEKLGDISNGLAIFLSTAPKF
FEPTIKGLASAGLAGSNVRIGLEKPLGTDLPTSREINDAVASVFPEERTFRIDHYLGKET
VQNILALRFGNSLFEPIWNAAGIDHVQITVSETVGLEGRAGYYDDVGALRDMVQNHILQL
LALIAMEPPARFDGTSIRDEKVKVLRSLRPIAGREAGDLTVTGQYTGGASTGKIVAGYAE
ELGKDSRAETFVAIKAHVDNWRWQGVPFYLRTGKRMTERRSEIVVQFKPVPHSIFAERGG
VLQSNTLIIRIQPEEYVRLLVMAKEPGLDREGVRLREVPLNLSLEHEFAGTRRRIAYERL
LLDLLEGDPTLFVRRDEVEAQWTWIDAIRAGWETADVKPKPYAAGTWGPSAAIALTERDG
VTWNE