Protein Info for Ga0059261_0349 in Sphingomonas koreensis DSMZ 15582

Annotation: MarR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 PF13463: HTH_27" amino acids 27 to 94 (68 residues), 30.1 bits, see alignment E=1.2e-10 PF12802: MarR_2" amino acids 27 to 84 (58 residues), 47.9 bits, see alignment E=3e-16 PF01047: MarR" amino acids 27 to 85 (59 residues), 46.4 bits, see alignment E=7.4e-16 PF09339: HTH_IclR" amino acids 33 to 77 (45 residues), 22.1 bits, see alignment E=2.7e-08 PF01022: HTH_5" amino acids 34 to 74 (41 residues), 24.7 bits, see alignment E=4.3e-09

Best Hits

KEGG orthology group: None (inferred from 64% identity to swi:Swit_0097)

Predicted SEED Role

"transcriptional regulator, MarR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JCA5 at UniProt or InterPro

Protein Sequence (119 amino acids)

>Ga0059261_0349 MarR family (Sphingomonas koreensis DSMZ 15582)
MNAVSDQSLYNWKNTLIDYVRSGEPDLTNRQMALMLLVYLDSGPHTVRGLAKALNVSKPV
VTRALNRLGALGYLRRQRDETDKRNIFVARTPEGAEFLAEFGQFVTGDSHVGQPARHRA