Protein Info for Ga0059261_0344 in Sphingomonas koreensis DSMZ 15582

Annotation: Molecular chaperone (small heat shock protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF00011: HSP20" amino acids 44 to 139 (96 residues), 59.6 bits, see alignment E=1.5e-20

Best Hits

Swiss-Prot: 55% identical to HSPH_BRADU: Small heat shock protein HspH (hspH) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K04080, molecular chaperone IbpA (inferred from 71% identity to sch:Sphch_0798)

Predicted SEED Role

"16 kDa heat shock protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W860 at UniProt or InterPro

Protein Sequence (157 amino acids)

>Ga0059261_0344 Molecular chaperone (small heat shock protein) (Sphingomonas koreensis DSMZ 15582)
MRQIDLTPFRRSTIGFDRLFDMLEATARQSGSENYPPFNLERISDDRYRITIAVAGFKPD
EIEITAQQNLLLVVGKKAEAQDNNPVQMLHLGIANRGFERRFELADFVLVESANLNDGLL
VIELVREVPEAMKPKKIAIGSGDQTDDGAAIEHRSVG