Protein Info for Ga0059261_0342 in Sphingomonas koreensis DSMZ 15582

Annotation: lipoprotein releasing system, transmembrane protein, LolC/E family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 273 to 297 (25 residues), see Phobius details amino acids 317 to 346 (30 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 6 to 416 (411 residues), 379.8 bits, see alignment E=8.2e-118 PF12704: MacB_PCD" amino acids 30 to 236 (207 residues), 47.1 bits, see alignment E=3.6e-16 PF02687: FtsX" amino acids 277 to 409 (133 residues), 57.6 bits, see alignment E=1.2e-19

Best Hits

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 73% identity to sch:Sphch_0797)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JCD9 at UniProt or InterPro

Protein Sequence (416 amino acids)

>Ga0059261_0342 lipoprotein releasing system, transmembrane protein, LolC/E family (Sphingomonas koreensis DSMZ 15582)
MLLSRYERMIARRYLLPGRGEAFIFLVASISLVAVMLGVAALVIVMSVMNGFRAELFDKI
TGLNGHAVVQGYGGQLRDWRDIVAQAKKTPGVTGATPLIEQPLMASFQGRVEGVLVRGMT
VPDIRINPTLNKNVLIGDLKQLTPGCECIAIGSRLAQSLGATPGSSVSLLSPQGLTSPFG
TVPRIVSYRVAAIFEIGVYDYDKAFVVMPMEDAQTLLLMGDTVGMVELDTSNPDKVGEIL
APLARQVAGVGQLTDWRTLNATLFEALAVDRLVTFTVLSILILVAVFNILSSLIMLVRAK
TRDIAILRTMGATRSGLIKIFVTVGTVIGSLGILAGLILGFILLYFRQGVLTFLGFVTGQ
EIWDPSMRYLTELPAKTDPVEIAGIALMALVFSFLATLYPAFKAASTDPVQVLRYE