Protein Info for Ga0059261_0341 in Sphingomonas koreensis DSMZ 15582

Annotation: ABC-type antimicrobial peptide transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 25 to 173 (149 residues), 108.4 bits, E=4.7e-35

Best Hits

Swiss-Prot: 73% identical to LOLD_NOVAD: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K09810, lipoprotein-releasing system ATP-binding protein [EC: 3.6.3.-] (inferred from 79% identity to sjp:SJA_C1-17410)

MetaCyc: 48% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Lipoprotein releasing system ATP-binding protein LolD"

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

See A0A2M8W859 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Ga0059261_0341 ABC-type antimicrobial peptide transport system, ATPase component (Sphingomonas koreensis DSMZ 15582)
MSEPVLQTSGLKRTFSQGGADIHVLRGIDLTVGQGEIVALLGPSGSGKSTLLQAVGLLEG
GFEGSIRISGVEVGKLESHARTVTRRDKLGFVYQFHHLLPDFNALENVELPQLIQNATLA
DARARSEGLLTALGLGARLTHRPSQLSGGEQQRVAVARALANRPALVLADEPTGNLDEHT
ADIVLAEFLRLVRGEGAAALIATHNERLAAKMDRVVRLHEGVLE