Protein Info for Ga0059261_0249 in Sphingomonas koreensis DSMZ 15582

Annotation: Superfamily I DNA and RNA helicases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 778 PF00580: UvrD-helicase" amino acids 17 to 282 (266 residues), 301.9 bits, see alignment E=1.9e-93 PF13245: AAA_19" amino acids 21 to 265 (245 residues), 76.8 bits, see alignment E=6.5e-25 PF13361: UvrD_C" amino acids 287 to 633 (347 residues), 222.2 bits, see alignment E=4.6e-69

Best Hits

Predicted SEED Role

"ATP-dependent DNA helicase UvrD/PcrA" in subsystem DNA repair, bacterial UvrD and related helicases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W806 at UniProt or InterPro

Protein Sequence (778 amino acids)

>Ga0059261_0249 Superfamily I DNA and RNA helicases (Sphingomonas koreensis DSMZ 15582)
MSVPVASPDDPPYLRGLNAPQREAVLTTDGPVLVLAGAGTGKTAALTARLAHLLWTRRAY
PSEILSVTFTNKAAREMRERVRGLVGDAVEGMPWLGTFHAIGAKMLRRHAELVGLQNNFT
ILDTDDQLRLIKQLIAANDLDEKRWPARQLAGLIDGWKNKGLTPKDLDAGESELFANGRG
QSLYAQYQDRLRTLNACDFGDLLLHMLTILKTNRDVLQHYQQRFRYIMVDEYQDTNSVQY
LWLRLLAQERKNICCVGDDDQSIYSWRGAQVENILKFEKDFPGAKVIRLEQNYRSTPHIL
AAASGVIANNGGRLGKELWTEKDAGEKVRVVGVWDGPEEARRVGEEIENTQRREGKSLDE
FAILVRAQHQTREFEDRFIATGLPYRIVGGFRFYERAEIRDALAYLRLVHQGADDFAFER
IVNVPKRGLGDKAIAKIHQLARAEGIPLLLAAARILDTDELTPQARRALGNFVGDIARWK
DMYSSASPEEGAVVEATDTRIGGLPHTELAQIILDESGYTAMWQADRTAEAAGRLENLSE
LVRAMEEYETLGAFLEHVSLVMDNDGNADEPKVTIMTIHAAKGLEFDTVFLAGWEEGIFP
SQRALDEGGLASLEEERRLAYVAITRARRLATILHAANRRIYGQWTSSIPSRFVGELPKD
HVDEESTMSGGASLWRANWSEHADPFAHVGRGTGRGPGWQRAAAPSSTFTTAPKRVVESR
ASAVSLGNKGRDDLSLGMRVFHQKFGYGEIVEIEGNKLEIEFEQAGRKRVMDSFVSVG