Protein Info for Ga0059261_0217 in Sphingomonas koreensis DSMZ 15582

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 707 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF07715: Plug" amino acids 54 to 152 (99 residues), 70.1 bits, see alignment E=2.1e-23 TIGR01783: TonB-dependent siderophore receptor" amino acids 57 to 704 (648 residues), 318.4 bits, see alignment E=5.4e-99 PF00593: TonB_dep_Rec" amino acids 238 to 676 (439 residues), 158.1 bits, see alignment E=6.9e-50

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 62% identity to cse:Cseg_3921)

Predicted SEED Role

"Putative OMR family iron-siderophore receptor precursor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W7Y3 at UniProt or InterPro

Protein Sequence (707 amino acids)

>Ga0059261_0217 TonB-dependent siderophore receptor (Sphingomonas koreensis DSMZ 15582)
MKTTYGLLATAALGLTLPMTAQAHGDEEQKTDEIVVYGRGEEKNTLATGLDLSPRQTPQS
ISIVTREQLEDQAAVNVGDALAYTTGISVKAVDRGRNTLAARGFDITNYQLDGAPFATGN
IGLEKNSTAIFERIEVIRGANGLLQGAGEPSATINLVRKHATSHELTGSLDLEGGSWNRF
AATGDITVPITADGSVRGRLVAQYSRQDSFVDIEKSKGYLIYGVIDADLGANTRISIGAS
YQRDERDGTLWGQLPYWYADGTRTSWPRSKTTAASWNMWDTTEKTAFLTIDQRLGNRWSL
RADVAYHEQFEDSKLLWTGGYPDRATGIGMTAEGYWFQSRPKQWNVSVSARGNFDLLGRE
HELIVGGNYRHLSGGWTDRKPVSIAPIGDFNLWDGSKHPEPAWGDRFRSSGFGTTGQYAV
YGAARLQLLDPLKLIAGARISWWERNEEITLYTAAPYTISHKGRVTPYAGLVFDVTGSIS
AYASFTSIFNPQDNKDRNGDYLPPVVGNAYEAGVKGEWMNGRVRASAAIFRIEQDNFAVV
DQGFFVPGTTNPAMRPARGTVSEGYEAEVAGKVLTGWDLSLGWSAFRAKDANGEQVQQHH
PRRILRISTRYDFRGMLDGFSVGGSARWESEPPKTGVNPATQLRENVGQPAYLLVNAMAR
YRLNDNVSLQLNVNNLFDKRYFNNNLWFAGYVYGEPRNVRATLRLGI