Protein Info for Ga0059261_0201 in Sphingomonas koreensis DSMZ 15582

Annotation: Na+/H+-dicarboxylate symporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details amino acids 27 to 27 (1 residues), see Phobius details transmembrane" amino acids 19 to 26 (8 residues), see Phobius details amino acids 48 to 77 (30 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details amino acids 311 to 350 (40 residues), see Phobius details amino acids 361 to 384 (24 residues), see Phobius details PF00375: SDF" amino acids 5 to 411 (407 residues), 376.7 bits, see alignment E=7e-117

Best Hits

KEGG orthology group: None (inferred from 75% identity to swi:Swit_1206)

Predicted SEED Role

"Na+/H+-dicarboxylate symporters" in subsystem Propionyl-CoA to Succinyl-CoA Module

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JC14 at UniProt or InterPro

Protein Sequence (455 amino acids)

>Ga0059261_0201 Na+/H+-dicarboxylate symporters (Sphingomonas koreensis DSMZ 15582)
MAKKLTTFILIALVAGAIVGLGLHYGIHNSFGADSAGAEAELKTVAGYFSIVTTIFLRLI
KMIIAPLVFATLVAGIAHMGDTAALGRVGGRAVAWFICASLVSLTLGLILVNLFQPGVGL
NFPLPPVDATSGVEKAAFNLKDFFTHVFPASGIEAMAKNEILQIVIFSLFIGVAITAVGE
KAKPLVSAVEALVHVMLQVTNYVMRFAPIAVFAAVAGTLAERGPAIIGNLAYFMGTFYIA
MFTLWALLIGVCYLIVGKRTGLLVRYIRDPLLLAFSTASSEAAYPRTLEALDRFGVPPRI
ASFVLPLGYSFNLDGSMIYMTFATIFIAQAYGIDLTLGQEITMLLVLMITSKGIAGVPRA
SLVVIAATLGFFDIPEAGLLLILGIDHFLDMGRSATNVVGNAVASAVVAKWEGGRLDPIE
PADIEPPHAPTGGGPAVDEQSFSEFGKPPAGGSQA