Protein Info for Ga0059261_0193 in Sphingomonas koreensis DSMZ 15582

Annotation: phosphatidylserine decarboxylase precursor-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 transmembrane" amino acids 29 to 61 (33 residues), see Phobius details TIGR00164: phosphatidylserine decarboxylase homolog" amino acids 27 to 233 (207 residues), 204.5 bits, see alignment E=6e-65 PF02666: PS_Dcarbxylase" amino acids 56 to 230 (175 residues), 164.2 bits, see alignment E=1.6e-52

Best Hits

Swiss-Prot: 66% identical to PSD_SPHAL: Phosphatidylserine decarboxylase proenzyme (psd) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 68% identity to swi:Swit_0458)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JCB7 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Ga0059261_0193 phosphatidylserine decarboxylase precursor-related protein (Sphingomonas koreensis DSMZ 15582)
MPSLDKPPVVTNTVKWRWPAVHPEGRKYVLISAAVTMLFLFAIWDELGFLLIGVTIWVAA
FFRDPVRVTPQAEGQIISPADGLVTMIERVPVPREIAGPEGLNEETRVRVSIFMSVFDVH
INRTPVAGTIRQVVYIAGKFLNADLDKASEENERQHFVVETRDGLRVGFTQIAGLVARRI
VTFVKPGDMVAAGQRIGLIRFGSRVDVFLPDDYAPQVALGQRCVAGETVVGRKGAIAAEG
VAQ