Protein Info for Ga0059261_0139 in Sphingomonas koreensis DSMZ 15582

Annotation: Signal transduction histidine kinase, nitrogen specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF00512: HisKA" amino acids 142 to 200 (59 residues), 50.6 bits, see alignment E=1.6e-17 PF02518: HATPase_c" amino acids 247 to 367 (121 residues), 57.4 bits, see alignment E=1.9e-19

Best Hits

Predicted SEED Role

"Nitrogen regulation protein NtrB (EC 2.7.13.3)" (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W7K7 at UniProt or InterPro

Protein Sequence (370 amino acids)

>Ga0059261_0139 Signal transduction histidine kinase, nitrogen specific (Sphingomonas koreensis DSMZ 15582)
MAPSRSGLRPPPQAGEPDLTELFGGLPVAALVLDPQDRVVRANMACEHLLNHSEKAMLGQ
RLDRIVTPPEGYLGRRDGHGFAAFDVEIEPTRSPRTRVDFIEQPISEHPGWRIVTLHQAP
TSRRLSVGADRSAGARAAVGAAAMLAHEIKNPLSGIRGAAQLLADDDGADGGEGRVELTK
LITDEVDRIAALIDRMQDFTDTRPPKLAPHNIYPLLDHARRVALAGFARGITIEERFDPS
LPPVMMDRDAFQQVAMNLLKNAAEALKDTPDPKIVLVTQYRHGVAMRPGPDQPRRWLPIE
FSVSDNGPGAPADIASHLFEPFVSGKPEGKGLGLPLVEKLVRDMGGVVEYARAGDPEMTV
FRVNLPRADG