Protein Info for Ga0059261_0111 in Sphingomonas koreensis DSMZ 15582

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 signal peptide" amino acids 12 to 14 (3 residues), see Phobius details amino acids 33 to 34 (2 residues), see Phobius details transmembrane" amino acids 15 to 32 (18 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 123 (18 residues), see Phobius details amino acids 130 to 146 (17 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 51% identity to gym:GYMC10_2333)

Predicted SEED Role

"FIG01204610: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W7I6 at UniProt or InterPro

Protein Sequence (176 amino acids)

>Ga0059261_0111 hypothetical protein (Sphingomonas koreensis DSMZ 15582)
MHRHLQDLFGKAQQLGQLIAILGFGVAVPTALATTSPETFGSVALWRGLLALLLVLDIAA
GCVANFTRGTNDFYAERPRNRWIFIAIHVHIVAVAALLNLDVAASIAVWGYTIASAILIN
LLAGKPSQTFAGGLLLSAGLTGIALWPGLSPFMGAVCALFMLKVLFSFAVDHYRHG