Protein Info for Ga0059261_0094 in Sphingomonas koreensis DSMZ 15582

Annotation: Protease subunit of ATP-dependent Clp proteases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF00574: CLP_protease" amino acids 27 to 206 (180 residues), 280.1 bits, see alignment E=4.2e-88

Best Hits

Swiss-Prot: 79% identical to CLPP_NOVAD: ATP-dependent Clp protease proteolytic subunit (clpP) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K01358, ATP-dependent Clp protease, protease subunit [EC: 3.4.21.92] (inferred from 85% identity to swi:Swit_0593)

MetaCyc: 66% identical to ATP-dependent Clp protease proteolytic subunit (Escherichia coli K-12 substr. MG1655)
Endopeptidase Clp. [EC: 3.4.21.92]

Predicted SEED Role

"ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent or cAMP signaling in bacteria (EC 3.4.21.92)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JBM7 at UniProt or InterPro

Protein Sequence (219 amino acids)

>Ga0059261_0094 Protease subunit of ATP-dependent Clp proteases (Sphingomonas koreensis DSMZ 15582)
MHPLSGHMTVDPVTGALVPIVIEQSSRGERSFDIFSRLLRERIIFITGPIEDHMASLITA
QLLFLESENPKKDIWMYINSPGGVVTAGMAIHDTMQYIRPRVGTVCIGQAASMGSFLLAA
GEPGLRVALTNARIMVHQPSGGAQGMASDIEIQAKEILRIKRRMNDLYVKYTGQPLEKIE
AAMDRDTFLEADEAKAFGLVDEVYEKRPQPAEGEGGSAA