Protein Info for Ga0059261_0064 in Sphingomonas koreensis DSMZ 15582

Annotation: Domain of unknown function (DUF4112)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 transmembrane" amino acids 52 to 74 (23 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details PF13430: DUF4112" amino acids 27 to 127 (101 residues), 110 bits, see alignment E=3.4e-36

Best Hits

KEGG orthology group: None (inferred from 65% identity to sal:Sala_1501)

Predicted SEED Role

"Bll7046 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W7D6 at UniProt or InterPro

Protein Sequence (139 amino acids)

>Ga0059261_0064 Domain of unknown function (DUF4112) (Sphingomonas koreensis DSMZ 15582)
MAEATRMDPEPETVSYTGNDPASVRYRIEMIEKLLERAVTIPGTRQTVGFDAVLGLIPVA
GDIVAAAMGAYMIWEARNLNMPRSAMFRMAGNVGFDWLIGLVPGLGDAADFFFRSNTRNL
KIIKKHLDKHHPGTATIRN